GLP-1 (C)

Research Area:

Metabolics

Chemical Information:

• Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
• Molecular Weight: 4409.01 g/mol
• Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP  *)
• *) Note: Where “X” denotes a non-standard or modified N-terminal residue (γ-glutamyl-linked moiety) as defined by the compound structure.
• Molecular Structure:

↺ + − ⛶

Product Description:

This is a synthetic peptide analog supplied in lyophilized powder form for use in qualified laboratory environments. The compound is intended for in vitro and analytical research applications involving peptide interaction and assay-based systems under controlled experimental conditions. This material is provided strictly for research use only and has not been evaluated for clinical, therapeutic, or diagnostic use.

Product Designation Note:

This product is identified using an internal designation for cataloging and differentiation purposes. It is not marketed, labeled, or represented as any approved pharmaceutical or therapeutic compound..

Research Applications:

In laboratory research settings, this peptide analog is utilized in controlled experimental systems to support investigation of:

• Peptide interaction characterization in defined assay systems
• Receptor binding interaction modeling in controlled experimental environments
• Structure–property relationship analysis
• Stability, degradation, and binding behavior under experimental conditions
• Comparative evaluation of peptide analog modifications

These research activities are conducted in non-clinical, non-therapeutic contexts.

Storage and Handling:

• Store the lyophilized powder at -20°C.
• Once reconstituted, store at 2-8°C and use promptly.
• Maintain aseptic handling practices to ensure product quality and sterility.

Product Specifications:

• Purity: ≥99% (HPLC Certified)
• Appearance: Lyophilized white powder
• Solubility: Soluble in suitable laboratory agents

Compliance Notice:

This compound is FOR RESEARCH USE ONLY. It is not intended for human or veterinary use. This product has not been evaluated by the FDA. Misuse of this product is strictly prohibited and may violate federal, state, or local laws. By purchasing this product, buyer represents and warrants that it will be used only for in vitro research purposes.